Mycoplasma hyorhinis SK76
Average proteome isoelectric point is 7.88
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 751 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|K7X8P0|K7X8P0_MYCHR Lipoprotein VlpG
MNRGKVKKSIFSKKLLVSFGSLVALTAIPLIAISCGQTTNKPSQSQQPGSGSTTETGGQTDSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSG
QADSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSGQADSTSGTSSTTETGSTTESSGQADSTSGTSTSI
Molecular weight: 33.91 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|K7X9Q2|K7X9Q2_MYCHR 30S ribosomal protein S20
MANIKSKIKAIASNEKARVRNNAIKSRVRTAIKKAKVAAMHNQDNVAALVAKAHKEINKAVTKGVFHRNNAARKTSRLDLFVQKHQSLNA
Molecular weight: 9.95 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
750 |
1 |
751 |
250,238 |
50 |
3,704 |
333.7 |
38.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.04 |
0.39 |
5.05 |
6.51 |
6.3 |
4.17 |
1.43 |
9.23 |
10.73 |
9.77 |
1.37 |
7.68 |
4.29 |
2.6 |
2.71 |
7.23 |
5.24 |
5.39 |
1.0 |
3.86 |
Note: For statistics only major isoforms were used (in this case 750 proteins)
For dipeptide frequency statistics click
here