Microbacterium trichothecenolyticum
Average proteome isoelectric point is 6.04
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 4,075 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0M2HA44|A0A0M2HA44_9MICO Uncharacterized protein
MADDNNNLLGLQTNVDLADSLNDNSDNSDNSDNSDNSDNSDNSTDSSSNNAAVGIGNQSDNSDNSDNSDNSDNSDNSDNSDNSDNSDNSVDTDTDTEDSYNDNSDNSTETEDSYNDNSDNSVDNSMETEDSYNDNSDNSDNSDNSDHSTNVSITDSFNTQTLNDHSISTGVRQYQTGFRDLNLGGGAGGA
GLAAGAGGLTIDSRTSMFDQSVNQNIWADGSVSQVFGQTGGLASGDGSAAAGDDVDIDNSTNWDVDIEDSFNPIDVSISDAFNDNSDNSDNSDNSDNSDNSDNSDNSDNSDNSDNSDNSMNWDLDTDISDAFNDNSDNSDNSDNSIDTDVDIDDSFQDNSMSADLDDSFNEYDTDVDVDLENDGIVNSPD
ATQADFDM
Molecular weight: 41.12 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0M2HEW8|A0A0M2HEW8_9MICO Uncharacterized protein
MGSVIKKRRKRMAKKKHRKLLRKTRHQRRNKK
Molecular weight: 4.08 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,075 |
0 |
4,075 |
1,369,450 |
29 |
2,346 |
336.1 |
35.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.95 |
0.48 |
6.44 |
5.62 |
3.16 |
9.05 |
1.96 |
4.46 |
1.82 |
9.84 |
1.73 |
1.88 |
2.66 |
5.56 |
7.27 |
5.43 |
6.05 |
9.01 |
1.62 |
2.03 |
Note: For statistics only major isoforms were used (in this case 4,075 proteins)
For dipeptide frequency statistics click
here