Lactobacillus oligofermentans DSM 15707 = LMG 22743
Average proteome isoelectric point is 6.31
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,735 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0R1RH96|A0A0R1RH96_9LACO Uncharacterized protein
MAESLSLSCLESDSEGVFEALSDALLVETDSLSDFTSEAEIDDDSEALSLISTDFESEVDLASEIDVEAESEIEFEVEVLFEATSESDVSVESEVLFEALAEVESEMFCESESEVEALTEVLSSESCDLLTDFESESLLLFSVDSDFSAESDDDVDSDFSVESDFSVDSEAEVEALFEAELLASVESETE
SDSDGVNEAPIDFEVEAEVEAEVLAEVAAESDLLAEACAESEALVEAESETNVESLVESETLVEPDTEASSLIDVDFEMLSDLLVEATAELLFEVLADSDVDFWAKSETEVDLLIESESDVDNESDSDGVTETFSDLLIEAESEFNVESDLFNEAEVEALNDVEVESEISFEVDLLSEVEALVEPSVAID
FEVEALVEVEAEVLLASESEADLLALACSDSE
Molecular weight: 44.54 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0R1RR17|A0A0R1RR17_9LACO Uncharacterized protein
MGLIWSLIVGAIIGAIAGAITNRGAAMGWIANIVAGLIGAWIGQGLLGTWGPSLAGMALIPSIIGAIILVLIVSLVVGRTSKK
Molecular weight: 8.26 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,721 |
14 |
1,735 |
531,743 |
50 |
2,788 |
309.0 |
34.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.38 |
0.43 |
5.96 |
5.88 |
4.38 |
6.59 |
1.92 |
7.91 |
6.53 |
9.36 |
2.83 |
5.33 |
4.26 |
3.25 |
3.49 |
6.73 |
6.23 |
7.1 |
0.98 |
3.45 |
Note: For statistics only major isoforms were used (in this case 1,721 proteins)
For dipeptide frequency statistics click
here