Candidatus Levybacteria bacterium GW2011_GWA1_39_34
Average proteome isoelectric point is 7.46
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 339 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G0NN63|A0A0G0NN63_9BACT Cell surface protein
MRSISRKKLLLFGFLAVLMLAIPLTVYLVQQQQETRSGAQAATNLQLCPPGETNCPPLQPPFTNKFTQTVKKGDEVQVEVKINPDINAVTWIKFLVKYDPQVLSLKTDDGGEIIAFEQNASSQFIIDPNIPPVYDPDLGTISVEMAINALNPGITGGVQTLGTLNFVAEEVTVTEADPAAFTSLSFDMTA
GNTDARSSLESEPKEPVIANAIGTDVIIEASEDVEPTAESTEAPTAEPTEGDGGNEEGGDTNQAPVCESFTVDETEGTAPLSITFTTEGFDPDGIVSKITFNFGDGPAQDLTETGGIGEEASVSAQIGHTYSTDGEFTATATFIDDNNATSDPNFCSETISVGGGGAIATATPEPTLPATGPDKTVVGVG
LLGAILTVLGFVIFFAL
Molecular weight: 41.54 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0NLC6|A0A0G0NLC6_9BACT 30S ribosomal protein S20
MPVTKSAKKKLRKDRKRELVNRRFETTLRKTVKDTRKNTSAKRLQEAFSVIDKASKKNIIHKNRAARIKSGLSKLVSKPAKTAKTAVKPTVKKVTPKKTSKSKK
Molecular weight: 11.83 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
334 |
5 |
339 |
92,637 |
39 |
1,720 |
277.4 |
31.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.59 |
0.51 |
4.98 |
6.55 |
5.27 |
7.01 |
1.45 |
8.08 |
8.03 |
10.14 |
1.8 |
4.32 |
2.94 |
4.23 |
4.44 |
7.38 |
5.42 |
6.72 |
0.87 |
3.28 |
Note: For statistics only major isoforms were used (in this case 334 proteins)
For dipeptide frequency statistics click
here