Escherichia hermannii NBRC 105704
Average proteome isoelectric point is 6.6
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 4,159 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|H5UYJ0|H5UYJ0_ESCHE Uncharacterized protein (Fragment)
MSGAVGLVKAVIGQVFVVSTDGTQRLLIEGDRIFEGEQVLTGAAGAVTLSLADGKTLDLGRDTVWDANGITLPSASDQADVAALQQAIADGMDPTQTLDPTAAGPQAGATGAGTPGGGGAHTHVVLDLTGEILDPSAGYPTTGLDFPNDTPLEELTLLDEGDADADADADADADADADADADADADADAD
SDADADADSDADADADADADADADSDADADADSDADADADADADADADADSDADADADSDADADADADADSDADADADADADADADADADADSDADADADADADSDADADSDADADADADADADADADADADADADADSDADADADADSDADADADADADADADADADADADADSDADADADSDADADAD
ADADADADADADADADADADADADADADADADADADADADADADSDADADADADADSDADADADADADADADADADADSDADADADADADA
Molecular weight: 45.22 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|H5V5Q3|H5V5Q3_ESCHE Uncharacterized protein
MFRWGIIFLVIALIAAALGFGGLAGTAAGAAKIVFVVGIILFLVSLFMGRRRP
Molecular weight: 5.56 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,891 |
268 |
4,159 |
1,239,873 |
40 |
4,081 |
318.7 |
35.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.99 |
1.08 |
5.29 |
5.64 |
3.82 |
7.47 |
2.3 |
5.68 |
4.1 |
10.79 |
2.77 |
3.74 |
4.47 |
4.56 |
5.78 |
5.79 |
5.39 |
7.12 |
1.53 |
2.7 |
Note: For statistics only major isoforms were used (in this case 3,891 proteins)
For dipeptide frequency statistics click
here