Ajellomyces capsulatus (strain NAm1 / WU24) (Darlings disease fungus) (Histoplasma capsulatum)
Average proteome isoelectric point is 6.95
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 9,252 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A6RGL6|A6RGL6_AJECN Viral protein TPX
MKVAFGSALLSAFALQRASASFNFPGFPGFPGFPGFPGFPGFPGFPDPSPSDHPGYPVEPTPTDYPVEPSPTDYPVEPTPTDYPVSAEPTTTDYPVEPTPTDYPVESTPTDYPVSAEPTPTDYPVEPTPTDYPVESTPTDYPVEPTPTDYPPTPTDYPVEPTPTDYPVESTPTDYPVSAEPTPTDYPVSP
EPTPTDYPVEPTPTDYPVESTPTDYPVEPTPTDYPVSPEPTPTDYPVEPTPTDYPVESTPTDYPVEPTPTDYPVSPEPTPTDYPVSPEPTPTDYPVSPEPTPTDYPVEPTPTDYPVESTPTDYPVEPTPTDYPVSPEPTPTDYPVSPEPTPTDYPVEPTPTDYPVESTPTDYPVEPTPTDYPVEPTPTDY
PVESSPTDYPVSPEPTPTDYPVSPEPTPTDYPVEPTSKDYTVSPAPTDATDYPVSPAPTDATDYPVTPEPTPTDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPAPTDATDYPVSPEPTPTDYPVSPAPTDATDYPVSPAPTDATDYPVSPEPTPTDYPVSPAPTDA
TDYPVSPAPTDATSNCL
Molecular weight: 62.69 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A6R050|A6R050_AJECN Ribosomal protein L39
MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI
Molecular weight: 6.25 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
9,252 |
0 |
9,252 |
4,057,025 |
30 |
4,863 |
438.5 |
48.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.96 |
1.28 |
5.63 |
6.33 |
3.58 |
6.63 |
2.53 |
5.12 |
5.12 |
8.8 |
2.11 |
3.94 |
4.16 |
6.09 |
6.57 |
8.43 |
5.86 |
5.81 |
1.38 |
2.67 |
Note: For statistics only major isoforms were used (in this case 9,252 proteins)
For dipeptide frequency statistics click
here