Lacinutrix sp. (strain 5H-3-7-4)
Average proteome isoelectric point is 6.85
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 2,958 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F6GE71|F6GE71_LACS5 Hemolysin-type calcium-binding region
MDDGTVDLDPNTPGQQGTFTVPGEGTYTDNGDGTVTFDPEPDFDGVSTINYTVNDNDGNVSNTAPITVTVEDAPVALDDTGSSTAPVSDANTVSVNVVSNDTDSDGTIDVSTVDLDPSTAGIQDTFTNVDGTYTVDANGVVTFDPNAGLTTDPTPITYTVNDNDGNTSNEASITITYGEGPVALGDSATT
GSDEDVVIDITLNDTDGDGTIDDGTVDLDPNTPGQQGTFTVPGEGTYTDNGDGTVTFDPEPDFDGVSTINYTVNDNDGNVSNTAPITVTVEDAPVALDDTGSSTAPVSDANTVSVNVVSNDTDSDGTIDVSTVDLDPSTAGIQDTFTNVDGTYTVDANGVVTFDPNAGLTTDPTPITYTVNDNDGNTSNE
ASITITYGEGPVALGDSATTGSDEDVVIDITLNDTDGDGTIEQ
Molecular weight: 43.09 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F6GHH5|F6GHH5_LACS5 Uncharacterized protein
MPSGKKRKRHKVATHKRKKRRRANRHKKKK
Molecular weight: 3.76 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,947 |
11 |
2,958 |
1,002,956 |
30 |
3,167 |
340.3 |
38.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.41 |
0.77 |
5.58 |
6.46 |
5.26 |
6.01 |
1.64 |
8.15 |
8.21 |
9.1 |
1.98 |
7.07 |
3.33 |
3.19 |
3.04 |
6.32 |
6.4 |
6.12 |
0.94 |
4.03 |
Note: For statistics only major isoforms were used (in this case 2,947 proteins)
For dipeptide frequency statistics click
here