Novosphingobium sp. P6W
Average proteome isoelectric point is 6.57
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 5,180 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0D1CJV3|A0A0D1CJV3_9SPHN Scaffold4 whole genome shotgun sequence
MTGPATGVSVGGVPILGPSGPGSLIDVNVAPPAGSTGSGSGIVVDVLTGDGNVVQVTLPTTTAQTQQALAPVGALAGALLGEPVGTTVTGLTNGLSPTVAAVTSTVSGVTTPLLDTVDTVLAPVVGSGGLLAPLTGQLGGLVSGVTGSLPGSGSGAAPTYTGPLVGLDLANNGLTGASTSGTLVGANVLS
NNPGLVSGQLVTADVLSDGAVLDVTLPTTAAGVAQGLAPVGNLAGALLGAQVGSGVTQVTDGLAPVVAPVTLVVDTVTSPVLDAVNGALGPLVGQVVGGLGAGETGSSVLSPVTGVVGGLLGGVSGGSGAGTVLAPVTGVVSGLLGGVGGGSGAGTVLAPVTGVVSGLLGGVGGGSGAGSALAPVTGVVS
GLLGGVGGGSGAGSALAPVTGVVSGLLGGVGGGTGSGTASLLSPVTGLLGGLTGS
Molecular weight: 38.75 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0D1CIF1|A0A0D1CIF1_9SPHN 50S ribosomal protein L34
MKRTFQPSNLVRARRHGFRLRMSTVGGRKVIRARRARGRAKLSA
Molecular weight: 5.11 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,138 |
42 |
5,180 |
1,679,293 |
26 |
4,171 |
326.8 |
35.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.07 |
0.82 |
5.85 |
5.38 |
3.62 |
9.08 |
2.01 |
4.85 |
2.99 |
9.79 |
2.46 |
2.63 |
3.18 |
5.23 |
7.08 |
5.51 |
5.37 |
7.27 |
1.46 |
2.34 |
Note: For statistics only major isoforms were used (in this case 5,138 proteins)
For dipeptide frequency statistics click
here