Rhodobacteraceae bacterium PD-2
Average proteome isoelectric point is 6.29
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 4,616 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0B4FK09|A0A0B4FK09_9RHOB Contig32 whole genome shotgun sequence (Fragment)
GDGGVVDAVLGDDGLLDGVAGDDGLVDTALDTVTGDGGVVDAVLGEGGLLDGVAGDDGLVDSALDTVTGGGGLFGSLLGALAPEDTVAGGAALLAAEPEMPVDAAGDAEAEVDAASGTALDDALTEGLLSASGDDTLAGDDSSSDRGLDADGPLEAVTGTDGLVGAAPDSLTTLDDPADTGPGDDLGDDL
GEDDFVDTLLASGGDEDLLSGLVGDDDVFGIDVPPDLVEDVDDLTAGLGGLADMGGSLIEQGLLADEAGPDDEIDSLLTQILGSSVDGDVTNSGPGIFDLLIGGEADPEETAAETETGDAGLLGQAEIDGVLSSLFDTGGGLLGGLGGAEDEAG
Molecular weight: 32.87 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0B4ESA9|A0A0B4ESA9_9RHOB Contig22 whole genome shotgun sequence
MNSATIFNFRRGLPAVFHVRRFIIVGPAHLGGFLLRTPMHGPQIHVLKAALPLWHMSSKHRHRQAPRRVSAQ
Molecular weight: 8.22 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,585 |
31 |
4,616 |
1,359,594 |
34 |
3,204 |
296.5 |
32.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.64 |
0.92 |
5.98 |
5.99 |
3.63 |
8.95 |
2.05 |
4.8 |
2.84 |
10.24 |
2.81 |
2.38 |
3.14 |
5.19 |
6.99 |
4.94 |
5.52 |
7.42 |
1.4 |
2.18 |
Note: For statistics only major isoforms were used (in this case 4,585 proteins)
For dipeptide frequency statistics click
here