Roseovarius atlanticus
Average proteome isoelectric point is 6.04
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 4,236 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0T5NPV0|A0A0T5NPV0_9RHOB Uncharacterized protein
MIYGVLIAAVAVLLAVAALRPRPEPLGDQTAQASTETSEEETAAAEGDSEGSEDQAAASDSDSEGSEEQAASSESDTEGSEEQAASSEGDSEGSEDQAAASESDSEGSEEQAASSESESEGSEEQAASAEGDSEGSEDQAAASESDSEGSEEQAASSESESEGSQEQAASSEGDSEGSEDQAASSESDSE
GSEEQAASSESDSEGSEDQAASSESDSEGSEDQAAASESDSEGSEEQAASSESDTEGSEEQAASSEGSSEGSEEQAASSESSSEGSEEQAASSEDSSEGSEEQAAASESDTESSEEQAASSENSSEGSEEQAAASESGSEGSEEQAAASESDNEGSDEQAASAESDSEGTQSSADQIAALEERVAALEAQ
LSESGSGSGDSGSASGEDTETFGVGSTAVLNDGDIRIFVSSIADDTVRFAVNGFNVQSAESGSEVELENGCMLTVESVENKTARFATACE
Molecular weight: 46.82 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0T5NV93|A0A0T5NV93_9RHOB Uncharacterized protein
MPRTRSPHSLRNRLKRALVRIRSRVPPGLRLVLGILLIIGGIFGFLPVLGFWMIPLGIAVASLDVVPLWRRLTGRLPKR
Molecular weight: 8.93 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,203 |
33 |
4,236 |
1,273,758 |
32 |
2,891 |
303.1 |
32.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.05 |
0.94 |
6.3 |
6.16 |
3.72 |
8.75 |
2.08 |
5.06 |
3.14 |
9.89 |
2.83 |
2.53 |
3.14 |
5.06 |
6.74 |
5.03 |
5.58 |
7.34 |
1.41 |
2.26 |
Note: For statistics only major isoforms were used (in this case 4,203 proteins)
For dipeptide frequency statistics click
here