Inquilinus limosus MP06
Average proteome isoelectric point is 6.72
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 6,228 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0A0CZP3|A0A0A0CZP3_9PROT Uncharacterized protein (Fragment)
MATFTGTNGAEILPNLILGPVQAIGNDFVDALGGDDIAIGWSGDDVIRGGAGADVIIGGLLNAAGVITLSGIDAADYTTSVDGVTVDLSVILDLTLPILGINIQLTGASQGFGGDAQGDYLVGIVNLIGSNTGDDNLSGSAAANTLNGQGGDDALDGQGGNDILLGGDGDDTLVGGGGADSLQGGAGTND
TADYSGSATPVTVNLTTGTGTGGDAQGDTLTGI
Molecular weight: 21.35 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0A0CYW8|A0A0A0CYW8_9PROT Iron ABC transporter (Fragment)
RWLTILPLGPATGRALGVSLARSRAALLLLAAILTAGATLTVGPLSFVGLMAPHIVRMLGLRRPTPQILAAGLLGAGLMVLADWLGRTIAFPWQVPAGLVATFVGGTYFIWLMQRRRPA
Molecular weight: 12.59 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
6,159 |
69 |
6,228 |
1,703,853 |
26 |
1,966 |
276.6 |
29.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.3 |
0.79 |
5.84 |
5.26 |
3.58 |
9.21 |
1.96 |
4.88 |
2.55 |
10.62 |
2.26 |
2.14 |
3.05 |
5.66 |
7.58 |
4.71 |
5.22 |
7.71 |
1.48 |
2.21 |
Note: For statistics only major isoforms were used (in this case 6,159 proteins)
For dipeptide frequency statistics click
here