Halopiger xanaduensis (strain DSM 18323 / JCM 14033 / SH-6)
Average proteome isoelectric point is 4.65
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 4,221 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F8DAB4|F8DAB4_HALXS Uncharacterized protein
MALLVAISGGPALAGATTTADDAEAGDVSATLENVQVETLELDNVTVENATIEELNVEEFDADTSELEDELDAGGENETTDTDAANETDNETASAGEEVTISDIQFEQLELENVSIEELEQDGDNATDAADDNETDVAVDEDDNETEVSVDEDDNGTDVTIDEEDNETAATDNESGQQSLIEEDTSELTV
QQLTIETMDVEQLSIDEITVEDGSDQMADNETDDNETDIAIDEDDNETDVAIDEDDNETDVTVDEEDNETDTTNATSSEQELEELTVEQFDVDEITVDSMTVQQVEEGTATDDGLDNETDDNETDIAIDDDDNETDVTIDDEDNESDTMTNETASDGETETVSQASASTIEIGNATTDTLTLGDAADLEN
IEQTDSDTAMNDTETNDTDTDVEVDVDDNDTEMTNDTELGDDNDTESAAILH
Molecular weight: 46.46 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F8DBY9|F8DBY9_HALXS Uncharacterized protein
MRLSTIAIVVGLGLIVIPIPVLPPFVGTILGVLVLLVGLFLRFLGL
Molecular weight: 4.82 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
4,191 |
30 |
4,221 |
1,221,691 |
30 |
1,656 |
291.5 |
31.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.77 |
0.73 |
8.8 |
9.43 |
3.22 |
8.3 |
1.92 |
4.28 |
1.71 |
8.82 |
1.7 |
2.38 |
2.5 |
4.67 |
6.54 |
5.52 |
6.26 |
8.52 |
1.15 |
2.77 |
Note: For statistics only major isoforms were used (in this case 4,191 proteins)
For dipeptide frequency statistics click
here