Roseibacterium elongatum DSM 19469
Average proteome isoelectric point is 6.36
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,433 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|W8RZB7|W8RZB7_9RHOB Alkaline phosphatase
MLAAGGLLALLLMGVAATGFVGADSDDDDKDQNSEDLGADDEETSLDPGEGEGSGLADLLFGTLDDDDLYGTEADEEILGLFGDDMIMGGEGDDTIDGGEGTDTLDGGEGDDHLVLDMSDVASGGEGADIFEVFTSTELTNGESIASVSDFEPGTDQLILDFPGEEAEAPEIAMDVESDPGNTLVLANGV
PVTVLQGVSVLDPGIVDVVMTGPAEGAPEDPSEGGSLVEGTPEDDTLAGGSGDDTIDGYAGDDLLNGGTGDDLLRGREGIDSLFGEGGEDAITGGPGDDILDGGTENDALFGNEGDDYVSGEAGNDEVYGDEGDDTVLGGEGSDFLSGGDGNDSVSGGADGDLLFGGDGDDTLSGGGGDDFLQGGFGADS
LSGGDGNDRIDGTFSNGHGTFGPTDEDDGDTLSGGDGDDILVLGAGDLASGGEGADIFASGDYIGEGDAAGSVSDFDPAEDVIEVLFDPDLTPNPEITVVDFADGTGADILLNGQIVLQVTGAQGLDPSLVELRELDLETA
Molecular weight: 51.87 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|W8S5B2|W8S5B2_9RHOB 50S ribosomal protein L34
MSKRTFQPSNLVRKRRHGFRARMATKAGRKILNARRARGRKSLSA
Molecular weight: 5.22 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,413 |
20 |
3,433 |
1,005,046 |
37 |
1,857 |
294.5 |
31.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.11 |
0.89 |
6.33 |
5.75 |
3.58 |
9.06 |
2.11 |
4.95 |
2.41 |
10.07 |
2.79 |
2.22 |
3.03 |
5.49 |
7.3 |
4.67 |
5.47 |
7.21 |
1.43 |
2.11 |
Note: For statistics only major isoforms were used (in this case 3,413 proteins)
For dipeptide frequency statistics click
here