Candidatus Woesebacteria bacterium GW2011_GWA1_37_7
Average proteome isoelectric point is 7.51
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 852 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G0H2P4|A0A0G0H2P4_9BACT Uncharacterized protein
MIYLNKKIATAFAAGALLLNTVAPVFAGTSIILSENGDGSDNDATVILGQSTTVVQSNNADVYNNVDAKAETGDNEASENTGGDVDIETGDATVNVNVENTLNSNSAEVDCCPSGDIDVLINGNGSDTDNTVDLKLGTETELYQNNYAKVKNIVDAEAETGDNEAEENTGGSVSIKTGNASTTVGLSTTA
NANSARIGGGGQGGSLSAIISENGDESDNDIVLSLGSLVLLAQSNVADVFNHVDAEAETGDNKAKENTGGEVEIETGDAEVDVTVDNMVNFNWADLECGCLLDDLFVKIWGNGSDTDNTIDAELGQETLAFQGNCAEDNQLPGDVSSLGGEGECELDNFVDAEGDTGDNKAEENTEGDGHDPSVSTGEAD
VEVDLENSGNVNVLGDGFELPFDEVDFGFNWAFFAAWFSWLAS
Molecular weight: 43.89 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0H0G9|A0A0G0H0G9_9BACT Uncharacterized protein
MRMQGFKSHLNAKKSKKRLRRLGKQVVTKKTFANKIKKVLGK
Molecular weight: 4.91 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
852 |
0 |
852 |
221,503 |
25 |
1,491 |
260.0 |
29.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.21 |
0.64 |
4.95 |
6.22 |
5.09 |
6.75 |
1.41 |
8.49 |
8.19 |
9.99 |
1.92 |
4.9 |
2.84 |
4.06 |
4.27 |
6.97 |
5.41 |
6.71 |
1.15 |
3.8 |
Note: For statistics only major isoforms were used (in this case 852 proteins)
For dipeptide frequency statistics click
here