Virtual 2D-PAGE plot for 7,824 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|M5RK76|M5RK76_9PLAN Uncharacterized protein (Fragment)
MCDYSGVDNGTVIESAPMQYDSGMEYAAPIDHGSMPMETEAAPPAAADLGPAEMESPSEEETTSPSDSPFNQAPATEDLEEQPAPVMPEETTPEPPATEPPATEPGPADDLFSQPAPAETEPAPAEPTEPAEPAQPAAPADDLFGDPAPAETTPAPADDLFGTPPPAETDPAPADDLFGDPPPAETEPAP ADNLFGDPPPADSDPAPADDLFGDPPADEADAMPSEEPALDDLFGSDAAPAGEESAAKPPMDDDIFGGSDATAEAEAPAEMPADESID
Molecular weight: 28.24 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|M5RH76|M5RH76_9PLAN Putative membrane protein
MFLFAHFGMSATLPSNFRRPLLLIVAIALLIGSATAWWLGGESSSKFAAAAMGRIGLVLAALWLAWPSLRRPARWFPPAVAVIGVISLMVLAAQPRLIFAVVPAAATLISITMMIRGFRGPPKG
Molecular weight: 13.23 kDa Isoelectric point according different methods: