Desulfovibrio aespoeensis (strain ATCC 700646 / DSM 10631 / Aspo-2)
Average proteome isoelectric point is 6.4
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,269 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|E6VQP7|E6VQP7_DESAO Uncharacterized protein
MTPAPPPPPTDDSVDVNDVLNAGKPENEGLDPDSLDADFEQELEDLFSDDLEEEGAAADEGDDEPIVLDEYVTVENDGNTEVQDDESMDDLAGDDEALLLLDDLTDEDDPMLLDDVAEPFSEGPAKDAGDDDMAALLDDIAEDNAPEPESDADEVIELDDLLDEGDDLADLDALLAEVDEAQGLDGDALA
DADVLESDADDDEDDVLLLDDTLSDTLLEEAMTDDTLSDDMLAEDFSAVADGDISAPQDLMEAALAEDAHTDLSVEESVAEDELDLLMDEPEGADHGGVSDLTGLDSLEDDIEDMDSLLDNVEVDVSGVVSGSADETGGGGVDFDDLPDADISDLDDSDLDIMGSDMGDVITAEAMPPDAGVDVSDDVDV
DQLLADVRTESASAPAAVPGSAPASVAELQDKVARLEARVAELETRIREEIAHLLPAEAARIIREEIAALAREMDD
Molecular weight: 48.11 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|E6VRJ3|E6VRJ3_DESAO 50S ribosomal protein L35
MPKIKTRRAAAKRFSKTASGKFKRRRKNLRHILTKKNAKRKRRLGQSTLVDSTNMKAVRRQLPNG
Molecular weight: 7.59 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,255 |
14 |
3,269 |
1,062,203 |
31 |
3,450 |
326.3 |
35.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.3 |
1.31 |
5.84 |
6.12 |
4.0 |
8.34 |
2.1 |
5.25 |
4.06 |
10.43 |
2.89 |
2.89 |
3.13 |
4.78 |
6.61 |
5.42 |
5.37 |
7.43 |
1.17 |
2.55 |
Note: For statistics only major isoforms were used (in this case 3,255 proteins)
For dipeptide frequency statistics click
here