Sulfobacillus acidophilus (strain TPY)
Average proteome isoelectric point is 7.19
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,722 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F8I2Q0|F8I2Q0_SULAT Flagellar hook-associated protein 2
MAINLGGLFGNNPIAQLLNDMSLQQFEALMTSGVQQQITTLNNQVNSFQAQESAWTTLKGDAAAVLSSLTTLTDSTTYQQLSGTSSNTQVINNVAVDGSAQSGSYSIQVDSLAAAELDQGQPPSAISSPTTALGITGSFSIQLGSAPTSSSTWISVTSGETLDQIAQAIDNANMGVTATVVSPASGQYTL
QIQANQTDQTIYYADGGSSDPLYTLGFVNSSGAKLSSVVLQAASPGTLQFGSNTSNIIDFSNNNAITNAIPGVTLSAVGTGTTTITIGPDTSAMVQNVQSFVNDWNQWVKDTENLALSTMPGAGLQTGAANFQVNPNQVLTSPIPVMVMNQVEASLGQWYGNTTLSSNPYQSLADLGITFSSSDNGTMTL
NQATLQAALNSNPTAVQNVFEAISGAVSTILNGFENGTNSTTGEAIAQLQTEVAQAQSNMTMADNQLVALQNQAITEYGQWVNAITSAASENQLLTNLYSPNSNSQSGG
Molecular weight: 50.59 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F8I305|F8I305_SULAT 50S ribosomal protein L34
MKRTFQPNRRHRAKVHGFRQRMRTRQGRAVLRRRRQKGRKRLAG
Molecular weight: 5.5 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,567 |
155 |
3,722 |
983,526 |
37 |
1,430 |
275.7 |
30.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.3 |
0.55 |
4.88 |
5.33 |
3.39 |
8.19 |
2.64 |
5.2 |
2.4 |
10.78 |
2.37 |
2.36 |
4.17 |
5.96 |
7.29 |
5.08 |
5.75 |
8.29 |
2.38 |
2.7 |
Note: For statistics only major isoforms were used (in this case 3,567 proteins)
For dipeptide frequency statistics click
here