Saimiri sciureus papillomavirus 1
Average proteome isoelectric point is 6.24
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 6 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|W5QK79|W5QK79_9PAPI Protein E7
MIGAQPTLKDIILSELPEPVDLQCNEDIDYDEVDNNEDVTQGHAGLYQVLCQCYTCYRDLRLLVKCTAEDVDILNSLLTGTLEIVCPLCARGMN
Molecular weight: 10.48 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|W5QK75|W5QK75_9PAPI Regulatory protein E2
MEGLTSRLDALQEQLIDCYEADSKNLEDHIHHWSLLRKENAYMYRARQLGMHKVGLQIVPPLAVSQQKAHQAIEMHLALQSLNKSQYRTEDWTLTDTSQEMWMCPPQKCFKKRGKRVEVWFDGRSENAMQYTLWTHIYVQREDGTWTKVAGYAEHKGLYYLQGKERCYYVDFQQECERYGTTGTWVVQGA
DGQNETCDSVSSTSTDATTAAAAALSFTGFTGQLQTTCKAAVPQPITSTPTKRPADTELDCAPKRGRLGDTSPKHRGPATHVAGHRAKYNSGCNNSSRVNSDNNGTDSDHQVAPVVLLKGDANCLKCHRFRLRKYSELYVAASTTWYWAAKTGSERLGQATVTVSFASEGQRARFLAKVPIPSGITVIQG
TMPI
Molecular weight: 42.97 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
6 |
0 |
6 |
2,252 |
94 |
647 |
375.3 |
41.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.44 |
2.8 |
5.95 |
4.75 |
3.55 |
6.88 |
2.13 |
3.6 |
4.57 |
7.9 |
2.0 |
3.69 |
4.35 |
6.53 |
5.51 |
6.93 |
7.99 |
6.93 |
1.78 |
3.73 |
Note: For statistics only major isoforms were used (in this case 6 proteins)
For dipeptide frequency statistics click
here