Methanobacterium lacus (strain AL-21)
Average proteome isoelectric point is 6.19
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,493 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F0TA63|F0TA63_METLA Uncharacterized protein
MKGIQIFKILGVLITLLVCLSGSYAANPNEVNTADNVNLQQADQTTTDLGYMADDSGADDSGVDDSGADDSGVDDSGADDSGADDSGVDDSGADDSGADDSGADDSGVDDSGADDSGVDDSGADDSGVDDSGVDDSGADDSGVDDSGVDDSGADDSGVDDSGADDSGADDSGADDSGVDDSGADDSGVDD
SGVDDSGVDDSGVDDSGADDSGVDDSGADDSGVDDSYTIDPVYEPLSDVYRTLTLEKFVADDLTTDDSSADDSGSDDTNPTDIYYTLATSEFTDGNAPLAAGGEETDDSGADDSDSGSGEVDDNGYDETGIDDGSSDDNGSDDNGIDDGSFDDNGSDEYTITAEQTGVAGNGGNGGKGGNGGNLSANDTL
NSTNSIPMQHTGLPILPALLGVLSLVSGFAINKRS
Molecular weight: 40.91 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F0T9X2|F0T9X2_METLA 50S ribosomal protein L39e
MSRNKPCAKKLRLSKATKQNRRVPLWVMLKTSRKVRTHPKMRQWRRSKVKA
Molecular weight: 6.2 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,477 |
16 |
2,493 |
710,554 |
30 |
2,864 |
286.9 |
32.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.06 |
1.12 |
5.6 |
6.95 |
4.15 |
6.99 |
1.69 |
8.92 |
7.49 |
9.1 |
2.77 |
5.76 |
2.49 |
3.63 |
3.38 |
6.56 |
5.78 |
7.17 |
0.8 |
3.61 |
Note: For statistics only major isoforms were used (in this case 2,477 proteins)
For dipeptide frequency statistics click
here