Virtual 2D-PAGE plot for 28,349 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|V4L649|V4L649_EUTSA Uncharacterized protein (Fragment)
GGAPGIIGSPPPPPLLGGGAPGGGAPGTTESPPPPPLLGSGAPGTTGTPPPPLVADIPPMPPITWFSPPDITTGSPPPSPVFLLPPPLDRSTLTPPAAQFPPAINTGTPPPAPVSPSLLPPPTDNLPPDIVIGQPLIPSPPDQSTPEFPPPDVTIEPPIDQSAPSPPVLPVILPPPVQDFPPILPPPVQD IPPILPPPVQDLPSILPPPVQEFPPILPPPVQEFPPILPPPVQEFPPILPPPVQEFPPILPPPVQDFPPIFSTPPIVQDPPIVPIFSTPPVVGDFPPQTPVFTTPPEVTNPWLPPVTSFAPPIESIPTIPENPFPVTPNPDMGSNQPLVQLPPPSWNSPPFNR
Molecular weight: 36.52 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|V4MEU6|V4MEU6_EUTSA Uncharacterized protein
MASSKVFLVASLLVALMFSSMIASSFAKKTIKPKFFRHHHFPRPGFPQFPRPGFPTNPMPFPQFPKPGFPQFPGQGLPNNPMPFPQFPRPGFPSNPTPGFPQFPGQGFPKLPSPLPQIPVSPSFPPATPGSPSGNVLPLPSITAPPTLPTTPISSP
Molecular weight: 16.75 kDa Isoelectric point according different methods: