Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)
Average proteome isoelectric point is 6.69
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 5,313 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A5VDI3|A5VDI3_SPHWW Hemolysin-type calcium-binding region
MANVIFEEGTQLQASGFVAGDTLLFKTAAPSDVGVTYNAPSGFNVATVTLTIGDQSLTFAANALGDASTNITFFAEDGQLVFGTAGNDAALAVTSDADSAVYGFDGIDTIDVSGDGNHLVYGGAGADAITVSGGEGNHNIFGDAGDDTIDAADAEGHLNIFGGAGNDSILGGSGNDHIYGQSAAGGTDGN
DTIDGGAGNDYIQGNAGEDQLNGGDGRDRINGGADDDTISGDAGNDTINGNKGDDVIDGGAGDDSLRGGAGDDQITGGDGNDVILGDLGDDTITGGVGTDLLTGGEGADVFVFGAGDVATTTIAGTKYYETITDFSTDEDIISLTGLTVTEDNLVFQNSGVSFTTVAAALDYVEGVLVTGSAAGSVAAIQ
VGADTYLFYDTDGEYTTDASIDGIIKLAGVTASDLTEDNFTLPA
Molecular weight: 42.04 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|A5VCE4|RL34_SPHWW 50S ribosomal protein L34
MKRTFQPSNLVRKRRHGFRSRSATPGGRKVLAARRARGRKKLSA
Molecular weight: 5.05 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,282 |
31 |
5,313 |
1,773,258 |
33 |
1,934 |
335.7 |
36.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.59 |
0.81 |
6.18 |
5.25 |
3.56 |
9.17 |
2.07 |
5.06 |
2.66 |
9.82 |
2.37 |
2.34 |
2.9 |
5.53 |
7.92 |
5.08 |
4.96 |
7.05 |
1.39 |
2.28 |
Note: For statistics only major isoforms were used (in this case 5,282 proteins)
For dipeptide frequency statistics click
here