Morelia spilota papillomavirus 1
Average proteome isoelectric point is 5.92
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 7 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|G3DRD1|G3DRD1_9PAPI Protein E7
MMIGPKLDVDLLCYEDLTSPNPDEAAIPAPPPSPSHPDLRAYTIDLGCGYCTKPLRFVTVATAECISLFNRLLLLDLYILCPECVDERDLDYYYGG
Molecular weight: 10.67 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|G3DRD3|G3DRD3_9PAPI Regulatory protein E2
METLRKRLDAVQEALLDIYETAENTLETQIKHWKLVRQEQTLLYFARQQGLSHIGLQTVPALQISESKAKEAIEIQLYLESLQNSKYGDEPWTMQETSALTFFAVPSRTFKKGPTTVVVQFEQHTQSYTTWTYLYIQTDTDMWTKYVGKVSNEGAYYSAGGGLKTFYISFSAEAKKYNTDNWTLVYKQLP
VLTSSITPLQSPTGTTDTAETQPAGGRPKRRYGRRSESPRPRRRREDQEASSPGGVPVAPEDVGSRNRTVEAKRSSRLARLLDEARDPPIVVLKGNPNSLKCLRYRLRHQYSKEFQHISTTFQWVDTVDSARLGRGRMLVMFTDDAQRMHFLKHVPLPKHITAFKGQLDGI
Molecular weight: 41.26 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
7 |
0 |
7 |
2,240 |
88 |
596 |
320.0 |
36.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.29 |
1.74 |
6.16 |
6.65 |
5.04 |
5.31 |
1.79 |
5.54 |
5.13 |
9.64 |
1.7 |
4.06 |
4.42 |
5.8 |
6.03 |
7.19 |
6.88 |
5.98 |
1.21 |
3.44 |
Note: For statistics only major isoforms were used (in this case 7 proteins)
For dipeptide frequency statistics click
here