Desulfobacterales bacterium SG8_35
Average proteome isoelectric point is 6.71
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 2,236 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0S8AG04|A0A0S8AG04_9DELT Uncharacterized protein
MKKKIVCFIVAAAGTLLISATDGYSYPSLCPDPGGNSCTTCHGAPDCPAPPPACNDSDGDGYGNPGDASCANGAATDCNDNNAAVNPAAPEICDNSDNNCDGRVDEGVTTTYYRDADMDTYGNPLNTADACSQPSGYVSDNTDCDDTDTAINPGAAENCTDGFDNDCDDLIDDADPSAVGCLVCTDNDED
GFAVEGGACGLPVDCNDDDPAINPDAVDLPNNGIDEDCSGADSVVDQDIDGDGVTAAEGDCDDLDPFNFPGNPEMCDGHDNNCNGLVDEGLTFDNDADGFTAIGSCEGSADDCDDSDPAINPGAVETCADGIDNDCDLLVDAQDDDAIDCPLDCTDTDLDNYATDGGDCGPVDCDDENADVNPGAEEICD
DAIDNDCDGAVDEGCDAACPDADGDGYQDSACGGMDCDDTDAAINPGAAEACGNGVDENCNGASDDTCLTCPDGSLLFIREMEYDRGDGELHIKGRATVGTTITIINSDTGEILAEEIRVREGKWKAEIEDVGSSLANITVISSNGCAVDREVERDEHDDEEDDREYHDDEDDEHDEDDDEERSDRRSRN
RRGNRSDD
Molecular weight: 60.2 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0S8ANM9|A0A0S8ANM9_9DELT 50S ribosomal protein L34
MKRTFQPSNIKRKRTHGFRLRMKTKAGRAVISNRRAKGRKRLSV
Molecular weight: 5.22 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,190 |
46 |
2,236 |
643,756 |
39 |
1,425 |
294.0 |
32.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.46 |
1.22 |
5.26 |
6.62 |
4.48 |
7.42 |
2.11 |
6.98 |
5.8 |
10.59 |
2.62 |
3.67 |
3.4 |
4.38 |
5.4 |
5.84 |
4.99 |
6.66 |
1.07 |
3.04 |
Note: For statistics only major isoforms were used (in this case 2,190 proteins)
For dipeptide frequency statistics click
here