Virtual 2D-PAGE plot for 1,156 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A0G1VTV2|A0A0G1VTV2_9BACT Uncharacterized protein
MLSDALALLLSEAEADLDSLAEGDKLLDSEGEALADPEALADLDSEVLGLNDFDSLGDSLDEAEALALFDSEAEAEADGDNDLLSEAEAEALAEALVDADGESDLLSEADADLDSEAEADVDGLRDLDSEALADLDSLALALADGLRLLLSEADADFDSDAEAEAEGLRLFDSDAEVEALGDNDLDSLAE ALALAEALALADGDSDLLSLALDEALADADSLALGDWLLDSLGLADLDSDLDSEAEGLNDLDSEGDSDAEALLDALALGLKLLLSLALADLD
Molecular weight: 28.9 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0G1YWG2|A0A0G1YWG2_9BACT 50S ribosomal protein L35
MPKFKVSKTITERFKITSKGKVLHLSGGLKHRRSKERANLMARGGGDKLISRADRRRLRRVLGV
Molecular weight: 7.3 kDa Isoelectric point according different methods: