Thalassobius gelatinovorus (Ruegeria gelatinovora)
Average proteome isoelectric point is 6.17
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,764 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0P1F699|A0A0P1F699_THAGE Hemolysin plasmid
MFMLTGLLGAMLAGVAIVGLVADFDSTDDDMLDEDPTDEGSDDTVVDIGTFFGVEAAPAEAEAIDAPNDGESDTILAGTEVSDVLTGGTGDDQIGGYGGEDSVLGGDGSDDLHGAEGNDLILGNDGDDVVHGEAGDDQLFGGAGDDQLYGHEGDDSLDGESGDDSLVGGGGNDALIGGSGSDALHGGLND
DSLTGGTGADTLFGGWGNDDINGNDDTDADFLNGGGGDDTINAGSADIVSLGDGSDTVLIGEWIEDPVTVTDFDMGEDIMLLIYDDSNGIDPVLELEPSQTTPGDMVLTMNGEAIATLNNVTTVNDANFVLMPQSSLESLSAA
Molecular weight: 33.4 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0P1G0D8|A0A0P1G0D8_THAGE 50S ribosomal protein L34
MKRTYQPSNLVRKRRHGFRARMATKAGRKILNSRRAHGRKSLSA
Molecular weight: 5.15 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,762 |
2 |
3,764 |
1,164,082 |
31 |
2,130 |
309.4 |
33.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.54 |
0.89 |
6.41 |
5.68 |
3.75 |
8.55 |
2.06 |
5.44 |
3.57 |
10.05 |
2.9 |
2.84 |
3.45 |
4.9 |
6.3 |
5.34 |
5.51 |
7.21 |
1.34 |
2.27 |
Note: For statistics only major isoforms were used (in this case 3,762 proteins)
For dipeptide frequency statistics click
here