Virtual 2D-PAGE plot for 8,019 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|H8MZW4|H8MZW4_CORCM Uncharacterized protein
MSQQWIWMSVAAGTLALGSASAQVDPNSAGAITTSQPNPGAAPGTPDPINTVSASPTTPLIGNVTGANSGTGGSGTSTGAVIPQPYSALPPSPANATTVTGAGTVVAPGSATTVTGTGAVLAPGTSSAVAGSTGSTATTGALMPPATTTPGTTLPGASISTVTPGTPTGTLSSMGAVLPPPTGMTPPGIT GAQPTILSPGGNTLPPDSNTSSNSVTPLGGGNVNQPPTP
Molecular weight: 21.29 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|H8MMJ7|H8MMJ7_CORCM Uncharacterized protein
MHAESNMQDPNETPSSNTMLPVGEATPSRRRSSGARKGARKASSRRTGAAKKATSKRTTAKKAAGKRTAKKAAGKRGTAKRGAAKKATAKRGARKAPARRAAAGRTARKTSARKSPARKTSARKSSARRSTRR
Molecular weight: 14.05 kDa Isoelectric point according different methods: