Candidatus Woesebacteria bacterium GW2011_GWE1_45_18
Average proteome isoelectric point is 7.5
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 682 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1M5U2|A0A0G1M5U2_9BACT Uncharacterized protein
MLGEALTDADGEIDGLAEGLGEADGETDGLTLGEADGLGDAEGETDGLALGDAEGLGEAEGERDGESDGDALGDGEAEGDKDGEAEGEALGDGEALGETECEALGLSEGLTLGDALGDGEAEGLAEGLALGEADGLGEALGLKLGDADGDALADETIEGEADSETEGDTDGDALIETLGDALGESEADGD
ALTDAEGEALGDGEAEGEALTEALGEAEGETLGEALGEGDADGDALSEALGEAEGDGLADGDAEGLRLGDAEGLGLADGEADGEAEGEALSDAEGEALGDGLAEGDALSLAEGDALGDGDADGLALSDALGDALGDALGDTDGEAEGDGEADGEALSEALGDGLAEGEALSDALSDADGEALAEPAVYVT
TTLI
Molecular weight: 36.65 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1Q5B2|A0A0G1Q5B2_9BACT 50S ribosomal protein L35
MPKQKSRKSVLRRFRITKRGKVLRRQAFRRHLKASKSKKRLKNLKKIIELKGHFAKRIRKLVGKKYES
Molecular weight: 8.27 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
682 |
0 |
682 |
181,726 |
24 |
2,170 |
266.5 |
29.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.58 |
0.57 |
4.71 |
7.01 |
4.9 |
7.77 |
1.47 |
7.13 |
7.83 |
10.31 |
1.75 |
3.73 |
2.65 |
4.37 |
4.92 |
6.29 |
5.32 |
7.17 |
1.27 |
3.21 |
Note: For statistics only major isoforms were used (in this case 682 proteins)
For dipeptide frequency statistics click
here