Fringilla coelebs papillomavirus (isolate Chaffinch/Netherlands/Dutch) (FcPV)
Average proteome isoelectric point is 6.07
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 6 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q8JNA7|Q8JNA7_FCPVN Putative E7 protein
MRNRLPIGAQGPPGGQPSNNPSENNFNPEDWDILLDTDSSSGSETETAEATSPSSSEESAEFDWEVKLIVTGNSQDPITLQELEDLNQVLVAELGHPATVYSIQDQADGASYPPGSPTPSTSTFPFETPQGNNQFTSMAVAGSSAAADPPSFPSPASVVDLVCHESMGDSDVDEEEHLPNNPANTPEESG
ANDTEFKCTICSKPLTEGELDEWGLVQGDEGLCHFCGFGAGVVDFFP
Molecular weight: 25.04 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q8JNA5|Q8JNA5_FCPVN Putative X-ORF protein
MELSNPQGLPQTDRCIGSCCSSNSSSSGMRLTLFCGSWCKVVAIGNGGHLPRIPMTQLLISTISRAQCRKLCTAAPYLFLKQCVCIHRMHCLLPIFSQLKRICAGLPPEGWLGTVADKLTMFICQMQNECLKHYPYETLEIVMPYTALRELYSHLQLTASQRRTKVSLILRDIRHCQLVRESKHQARGRK
DHRNYFNAA
Molecular weight: 22.57 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
6 |
0 |
6 |
2,540 |
199 |
694 |
423.3 |
47.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.54 |
2.05 |
5.91 |
6.34 |
3.39 |
7.2 |
2.28 |
4.29 |
3.86 |
8.58 |
1.69 |
4.41 |
4.17 |
7.09 |
6.38 |
8.54 |
5.83 |
6.54 |
1.54 |
3.39 |
Note: For statistics only major isoforms were used (in this case 6 proteins)
For dipeptide frequency statistics click
here