Enterococcus phoeniculicola ATCC BAA-412
Average proteome isoelectric point is 6.25
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,510 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|R3TQZ2|R3TQZ2_9ENTE LPXTG-domain-containing protein cell wall anchor domain (Fragment)
DADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADADA
DTDADADADADADADADADADADADSDGKHPITLPNGGHKGSGGGSSLMLGGKPLPKTNDTVSSELPVAGALLVGLSSLGLWIRRKFKRD
Molecular weight: 26.73 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|R3U5H7|R3U5H7_9ENTE 50S ribosomal protein L34
MKRTYQPNKRKRQKVHGFRKRMSTKNGRRVLASRRLKGRKVLSA
Molecular weight: 5.31 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,467 |
43 |
3,510 |
1,091,860 |
27 |
3,052 |
314.9 |
35.5 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.64 |
0.64 |
5.01 |
7.54 |
4.82 |
6.51 |
1.76 |
7.73 |
7.08 |
9.97 |
2.67 |
4.64 |
4.09 |
3.36 |
3.53 |
6.38 |
6.01 |
6.75 |
1.01 |
3.84 |
Note: For statistics only major isoforms were used (in this case 3,467 proteins)
For dipeptide frequency statistics click
here