Staphylococcus massiliensis S46
Average proteome isoelectric point is 6.47
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,323 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|K9AH63|K9AH63_9STAP Uncharacterized protein
MLSDALSDSLTDAESDSLTDAESDSLTDAESDALTDAESDALTDAESDSLVLSDVLSDSLTDAESDSLTDAESDSLTDAESDALTDAESDALTDAESDSLTDAESDALTDAESDSLVLSDVLSDSLTDAESDSLVLSDALSDSLTDAESDALTDAESDALTDPESDSLVLSDVLSDSLTDAESDSLVLSD
ALSDSLTDAESDSLVLSDALSDSLTDAESDSLTDAESLALVDALSDSLTDAESDALTDAESDSLVLSDALSDSLTDAESDALTDPESDSLVLSDALSDSLTDAESDALTDAESDALTDAESDALTDAESDSLVLSDALSDSLTDAESDALTDAESDALTDAESDSLTDAESLALVDALSDSLTDAESDAL
TDAESDALTDAESDALTDAESLALVDALCELDELVDALCELDSLVDALCELDALVDVLCELDALVDALCELDALVDALCELDALVDALCELDALVDALCELDALVDALCELDALVDALCELDALVDALCELDALVDALCELDSLVGSVTVTF
Molecular weight: 54.38 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|K9B305|K9B305_9STAP 50S ribosomal protein L34
MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
Molecular weight: 5.43 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,308 |
15 |
2,323 |
676,034 |
18 |
3,233 |
292.9 |
33.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.19 |
0.64 |
6.13 |
7.03 |
4.5 |
6.28 |
2.44 |
8.26 |
7.47 |
9.31 |
2.75 |
5.05 |
3.76 |
3.33 |
3.76 |
5.99 |
5.73 |
6.84 |
0.72 |
3.84 |
Note: For statistics only major isoforms were used (in this case 2,308 proteins)
For dipeptide frequency statistics click
here