Thalassobius sp. CECT 5114
Average proteome isoelectric point is 6.01
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,406 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0P1ITI7|A0A0P1ITI7_9RHOB Hemolysin plasmid
MELLIVFGLLTAGLIAVFQNDDDEATVDGGGDGGSDGGGDDGTGGGDGGPGDGGGGDGGMLGMLIEGTDGADSLAGAEGDDTINGLDGDDVIDGGAGDDDILGGLGDDTINGGEGDDTIGAAAGNDIIDGGEGDDSIRGGNDGDQISGGDGADFIDGANSGDVLLGEDGDDTILGGRGDDFLSGGAGADY
LDGGVGSDILYGAADDDELFGGDNDDLLVGEEGEDTLRGGGGDDILIGGGVGVSGDDDEILTFFTDDEGDVLRGEAGHDQIFMDTNDTVNGGIGEDVFLTGVYVDEDNTPIVNDWDDGEDILAIVVEEGAPGLVTIEEGDEAGQADVFVDGQKVAEVVGAFGTLTLDDITVVEADVTANTVSPIAA
Molecular weight: 36.83 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0N7MBA0|A0A0N7MBA0_9RHOB 50S ribosomal protein L34
MKRTYQPSNLVRKRRHGFRARMATKAGRKIINARRAQGRKSLSA
Molecular weight: 5.13 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,405 |
1 |
3,406 |
1,051,103 |
30 |
2,439 |
308.7 |
33.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.18 |
0.89 |
6.11 |
6.31 |
4.03 |
8.25 |
2.02 |
5.53 |
4.03 |
9.82 |
2.84 |
3.08 |
3.4 |
4.69 |
5.86 |
5.6 |
5.42 |
7.28 |
1.37 |
2.29 |
Note: For statistics only major isoforms were used (in this case 3,405 proteins)
For dipeptide frequency statistics click
here