Ardenticatena maritima
Average proteome isoelectric point is 6.61
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,144 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0M8K7P6|A0A0M8K7P6_9CHLR Uncharacterized protein
MYISPSQNKEWGADWLGESETIGIGGAQTFMIEPGQYDLEADDCDGNLVALQWNTPITADATWTVTGVAGALNFTLDPTFGEIHLTTGFSPDPYTISITGGGAVDVAAQNLPSAECTGYAAEAPDIRLFWAGSSARLRIFFQALEDTALIVNDPNGVWHCSDDFNGTIHPLVDILNPPEGQYDIWVGTFG
ENDAVEGTLYITEMDTTPQQPPDVPQDIHLLVDDFSDPNSGWDRVTFEDGSMAGYVDGAYAVVALTQNEIRGGMYPLGVPNVDIYIEATQVGAPTNNNDGYGVMCRVQPNGDGYSFLISGDGYFTIARVENQDYVPLIDWTYSDAIYQGNAMNSINAVCNETYLALWVNGELLGEVYDDTYATGDIALVA
GTLEPEPVEVHFDNLVVSRPLP
Molecular weight: 43.51 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0M8K8T8|A0A0M8K8T8_9CHLR 50S ribosomal protein L34
MPKRTLIRKRRRRMRVHGFRARMRTPGGRRVLKNRRRKGRHQLTVKIPRRWF
Molecular weight: 6.62 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,965 |
179 |
3,144 |
953,551 |
37 |
2,171 |
321.6 |
35.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.08 |
0.69 |
5.14 |
6.62 |
3.77 |
7.23 |
2.58 |
5.08 |
2.36 |
11.0 |
2.21 |
2.63 |
3.68 |
5.83 |
7.51 |
4.09 |
5.9 |
7.93 |
1.83 |
2.78 |
Note: For statistics only major isoforms were used (in this case 2,965 proteins)
For dipeptide frequency statistics click
here