Virtual 2D-PAGE plot for 5,740 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|K9TZ92|K9TZ92_9CYAN Uncharacterized protein
MATSDNQTTSQPETSSNNFTGNSNWAFQDGQLQSSEGNTLDESSNLSGGSSDPFSGGDTESDNNNPFAGGNAENNPQASNLPDNLPFGDTLPSLPEIETDQPVPFDSDNFILDVNNLESDSDSTGNTGSGNGNWNLGSNNTTDGNGNWNFSSDSQTNGNGNWNYADGNTSTGNGNWNFGTDNQTNGNGNW QLGESNTVLGNANMPEGSNNNILGSGNTADVSNSTLLGNRLEIGSDGSAIGNEDWAFPLSSDSEPISLGSSQPSQEIGFDISTGVSSLFGSGGATQETIDTATNLPDYNNPNYTFEGLG
Molecular weight: 32.05 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|K9TU46|K9TU46_9CYAN Uncharacterized protein
MKKINRFTKSQNLALRLFIILLLTAIAIWVLRGLGIITFLPGGIIWILLLVAIAAGVFSRFQRRWVRF
Molecular weight: 7.84 kDa Isoelectric point according different methods: