Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494)
Taxonomy: cellular organisms; Bacteria; Terrabacteria group; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces viridochromogenes
Average proteome isoelectric point is 6.71
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 7,706 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|D9X2G6|D9X2G6_STRVT Predicted protein
MGTEYTPADPSTGEPESNYGDTYSESEVTEDASGMGYTSTSDYVSGENALTPIDDSESDYESEEEDYGDGDDD
MGTEYTPADPSTGEPESNYGDTYSESEVTEDASGMGYTSTSDYVSGENALTPIDDSESDYESEEEDYGDGDDD
Molecular weight: 7.83 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|D9X401|D9X401_STRVT Integral membrane protein
MSSRTRTRASKRAAGVHTVQIPRQRGRRGAQPFVVVVPERPSLTREAFGFLARLLWKHRRAMAPLTLATVALPVTALLHWWAWWSGLLLAPLAVAPLTWLAFALLRRRAGRSVLLWRIGLATGGTSALAWLALAAGFGPTAGPLPVLWLLVTLAVQTAWLAIRRKG
MSSRTRTRASKRAAGVHTVQIPRQRGRRGAQPFVVVVPERPSLTREAFGFLARLLWKHRRAMAPLTLATVALPVTALLHWWAWWSGLLLAPLAVAPLTWLAFALLRRRAGRSVLLWRIGLATGGTSALAWLALAAGFGPTAGPLPVLWLLVTLAVQTAWLAIRRKG
Molecular weight: 18.2 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
2,470,256 |
32 |
3,604 |
324.1 |
34.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
13.17 |
0.82 |
5.99 |
5.77 |
2.72 |
9.49 |
2.33 |
3.07 |
2.22 |
10.22 |
1.76 |
1.77 |
2.78 |
6.19 |
8.3 |
5.13 |
6.11 |
8.5 |
1.54 |
2.11 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |