Erinaceus europaeus papillomavirus 1
Average proteome isoelectric point is 6.31
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 7 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|B7TQP1|B7TQP1_9PAPI E4 (Fragment)
ENIIPSDDPRPVKTGVDRLGALLDQWEDDLRTVRKELQQRLLTAYSGALGIQLF
Molecular weight: 6.12 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|B7TQP0|B7TQP0_9PAPI Regulatory protein E2
MERLTQRFDALQEKLMEIYEKDSRDLGVMTSHWALQREEQALLHCARRKGVLRVGFQPVPPLKVSEQKAKAAIEMHLTLQSLQKSAYSNEDWTLSQTSRESFMTPPRHCFKKQGHTVEVTFDGESANSMLYTMWGRVYYQMDDGSWSVASSGVDYYGIYYNDSEGKPHYYVKFAEDAQKYSKTGTWFVRS
NDKTISAPVTSTCTSPTTRDRSRSPRRHTEEVDSTTPPGRRYPPSSPPSVSSLRLRGRGGGEGEYYPFGRSSPSEDRCGSAGSPARPVGRRPPHCPQGTPAEASHRLLWGPRDPTVLVAKGDANTLKCWRNRCRKTHAGSFIAFSTTWQWCGDGNCRQGRHRLQILFSSSQQLDQFLGKVKVPKGVEVHR
STFDGL
Molecular weight: 43.61 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
7 |
0 |
7 |
2,282 |
54 |
597 |
326.0 |
36.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.13 |
2.32 |
6.44 |
5.96 |
4.43 |
6.97 |
1.88 |
4.43 |
5.74 |
8.94 |
1.75 |
3.81 |
4.29 |
5.43 |
6.0 |
7.58 |
6.57 |
6.53 |
1.45 |
3.33 |
Note: For statistics only major isoforms were used (in this case 7 proteins)
For dipeptide frequency statistics click
here