Phaeobacter sp. CECT 5382
Average proteome isoelectric point is 6.24
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,864 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0P1H1E0|A0A0P1H1E0_9RHOB Hemolysin chromosomal
MFVLAALGLSFVVGIAVLASDDDDPISTSDSDGGSDTGGGSETGGETGGGSETGGETGGETGGETSPLDPFYGEDDPDNVDGTDGNDTLYGGGGDDTLAGGLGDDGLDGEDGNDALDAGDGNDVLQGGYGNDQLVGGSGDDFLQGESNDDTLDGGAGNDGLHGGNGADSLTGGAGDDLLNGASLDIDDEL
LEEWLDNFESGQDPNSLGDEQTGIVDDFIGDTLNGGDGNDTLIGSAFDLLTGGEGADEIVVGDWSTSGFASVVTDFDTAEDMIVYRYDQNGTAPDLTTNTILNGDGTTDVEVRANGLSVVYLQNVGDEFALDTHVTLIEAIMAPVPT
Molecular weight: 33.69 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0P1H465|A0A0P1H465_9RHOB 50S ribosomal protein L34
MKRTYQPSNLVRKRRHGFRARMATKAGRKILNARRARGRKELSA
Molecular weight: 5.2 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,861 |
3 |
3,864 |
1,198,771 |
30 |
2,393 |
310.5 |
33.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.91 |
0.97 |
5.85 |
5.95 |
3.77 |
8.44 |
2.11 |
5.11 |
3.52 |
10.32 |
2.82 |
2.74 |
3.8 |
4.9 |
6.23 |
5.63 |
5.36 |
6.94 |
1.37 |
2.25 |
Note: For statistics only major isoforms were used (in this case 3,861 proteins)
For dipeptide frequency statistics click
here