Proteome-pI - Proteome Isoelectric Point Database statistics

Average proteome isoelectric point is 6.64

Acidic

pI < 6.8

6.8-7.4

pI > 7.4

Basic

All

* You can choose from 18 different methods for calculating isoelectric point

Protein with the lowest isoelectric point:

>tr|A0A0P9D2M9|A0A0P9D2M9_9BACL Uncharacterized protein 

MARLHDSDSRLAVEFGFGFGFGFGFGFGFGFEFEFEFEFEFEFEFEFEFEFEFEFEFEFEFEFEFEFEPD

Molecular weight: 8.7 kDa
Isoelectric point according different methods:

Protein with the highest isoelectric point:

>tr|A0A0P9C9U7|A0A0P9C9U7_9BACL Uncharacterized protein 

MLDPIIVLALIGLMVVLAVVGVHLLGLLLAILLVLLVLVLLGAFGVRSPVAVRRRHYRRRRRRRK

Molecular weight: 7.31 kDa
Isoelectric point according different methods:

Number of major isoforms	Number of additional isoforms	Number of all proteins	Number of amino acids	Min. Seq. Length	Max. Seq. Length	Avg. Seq. Length	Avg. Mol. Weight
4,106	36	4,142	1,201,825	26	1,718	292.7	32.4 kDa

Ala	Cys	Asp	Glu	Phe	Gly	His	Ile	Lys	Leu	Met	Asn	Gln	Pro	Arg	Ser	Thr	Val	Trp	Tyr
8.92	0.82	5.02	5.92	4.02	7.81	2.43	5.85	3.96	9.93	2.71	3.39	4.06	4.36	5.75	6.34	5.84	8.37	1.45	3.04

Note: For statistics only major isoforms were used (in this case 4,106 proteins)
For dipeptide frequency statistics click here

See this proteome in:

Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here

Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978

Contact: Lukasz P. Kozlowski