Vittaforma corneae (strain ATCC 50505) (Microsporidian parasite) (Nosema corneum)
Average proteome isoelectric point is 6.84
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 2,236 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|L2GP03|L2GP03_VITCO Uncharacterized protein
MQAASKEVVGNVNVVGETTPSLIVDDGQQLPQDFTSLTVTQPDPATIQPSTNVSDVFSNTPADSSLALANADDVSRNISLDQLETSGIGIESSSTTASQIEAAPVLDKPVAENSPTSDIVNAMPSESTDVVSTVNEPASVVNTMSSESTNIVSTQSEPTNVISTSQGEPVSVPSAEQSEPVSFDKPSLVE
ESEPTKVQQESSVNPSDDAALTSGDSQVTHQENVHHVSSNGENNDSIKATEQQLPTNQENIKSLTGTTDSKDVSTERLDDKPMETDPNAGDHASEATVNVEHPDQRNTAVGTVKQSVKNNEDTPSLDGQTDKQENGGSRDDSYLNPDVHNNGGDSHDEFENYRTENKRLHFRMALLTCLLILILLYSFDI
NAIKQSVSNSFDYLSDYVASLFGIQNTADDSTSVVCFGKGDNLDNVCANPNPPSI
Molecular weight: 46.32 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|L2GMX3|L2GMX3_VITCO Uncharacterized protein
MGSRKSTLVKRRLAKAFRMNQAVPAWKRETLSPRDGYNFKRRNWRSTKLKIY
Molecular weight: 6.3 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,236 |
0 |
2,236 |
714,266 |
39 |
2,539 |
319.4 |
36.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.55 |
2.04 |
5.51 |
7.18 |
5.65 |
4.34 |
1.91 |
8.17 |
8.36 |
9.97 |
2.32 |
5.91 |
3.03 |
3.14 |
4.41 |
8.35 |
4.8 |
5.85 |
0.57 |
3.93 |
Note: For statistics only major isoforms were used (in this case 2,236 proteins)
For dipeptide frequency statistics click
here