Actinoplanes missouriensis (strain ATCC 14538 / DSM 43046 / CBS 188.64 / JCM 3121 / NCIMB 12654 / NBRC 102363 / 431)
Average proteome isoelectric point is 6.6
Get precalculated fractions of proteins
Acidic |
![](../download.png) |
pI < 6.8 |
![](../download.png) |
6.8-7.4 |
![](../download.png) |
pI > 7.4 |
![](../download.png) |
Basic |
![](../download.png) |
All |
![](../download.png) |
Virtual 2D-PAGE plot for 8,113 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|I0H4K7|I0H4K7_ACTM4 Uncharacterized protein
MDDTQTPQPAPDTSVETTPVDSLVETDELIEEVSIDGMCGVY
Molecular weight: 4.53 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|I0HE89|I0HE89_ACTM4 Uncharacterized protein
MVATAIAVVTRVAATGAGSVAVTVTVVVTRVAATGAVSVVGTVRRATVVVSVVTVRRVTVRRVAASVVATVIVAATRVAATAVVSVVATVIVAVTRVAATAVVSVVATVTGAAIRVAATGVVSVVTVRRGAASVVATVTVAVTRVAATAVVSVVATVTVVVSRVAATAVVSVVGTVRRATAVVSVVTVRR
VTVRRVAASVAETVTVAVTRVAATAVVSVVGTVRRATAVVSVVTVRRVTVRRVAASVAETAIAVATRVAATAAVSAVTGRRVTGAATRVAATAAGSVAGTVTVAVTRVAATAAASVAGTVRVVRVRASRATAAGSVVATVRRVTVRRAAASVAETATAVATRVAATAAASVVTVRRVTVRRVAASVVATA
TAVATRVAATGAGSVVATVTGAATRVAATAGATRVATVVVTRVAATGAGSATTTAVATGGTSGTAPVRVRRTRPARRRSSPRTFPRTSSRPTSTRRSARN
Molecular weight: 46.86 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8,049 |
64 |
8,113 |
2,617,316 |
30 |
4,154 |
325.2 |
34.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.94 |
0.69 |
5.96 |
5.22 |
2.79 |
9.26 |
2.08 |
3.74 |
1.95 |
10.31 |
1.77 |
1.93 |
2.77 |
6.02 |
7.89 |
5.16 |
6.24 |
8.65 |
1.58 |
2.05 |
Note: For statistics only major isoforms were used (in this case 8,049 proteins)
For dipeptide frequency statistics click
here