candidate division CPR3 bacterium GW2011_GWF2_35_18
Average proteome isoelectric point is 7.04
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 1,062 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G0E4X2|A0A0G0E4X2_9BACT Cysteine-rich repeat protein (Fragment)
GDEEVNQTTEECDGTAGVGEHQECSAECTLIDVSYCGDGTTDEGETCDDGNVVDGDGCSAICTIEEEEEEPICGDGTVDEGETCDDGNTTDGDGCSSSCTTEEEQQPVCGNNIKETGEECDGTDGVTEGYTCSDTCTLDPEVVVTVCGNDVKETGEECDGEDGVIDGYQCSATCELETDDGDVLGENVTR
IPTTLPETGASLIALVNAMGAIILGLLLREKKLLIKKEN
Molecular weight: 23.83 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0ERI8|A0A0G0ERI8_9BACT 50S ribosomal protein L20
MRATTKVPSHKRHTKLLKRVKGFAKSRQLVRRAKETLLKSGQNAFAGRKQRKRNVRSLWIVRLSAAVKSQGLNYSLFIKKLKDNKIILNRKILSEIAINDPKTFDKIVKKIS
Molecular weight: 12.95 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,056 |
6 |
1,062 |
337,902 |
29 |
3,040 |
320.0 |
36.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.4 |
0.79 |
5.23 |
6.81 |
4.99 |
6.44 |
1.57 |
8.86 |
8.31 |
9.58 |
2.01 |
5.59 |
3.47 |
3.53 |
3.52 |
6.75 |
5.8 |
6.31 |
1.07 |
3.96 |
Note: For statistics only major isoforms were used (in this case 1,056 proteins)
For dipeptide frequency statistics click
here