Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418))
Average proteome isoelectric point is 5.98
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,701 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|K9YD19|K9YD19_HALP7 Uncharacterized protein
MEDQLLDAIPINDESVEADSQAEAGPNQTEDMDIDMETSEDEEPTPTPEEPEEPEQPEPPLGEQPEEPEPPIAEQPEEPEEPEQPEPPVGEQPEEPEEPEQPEPPVGEQPEEPEEPEQPEPPVGEQPEQPEEPEQPEPPVGEQPEEPEEPEQPEPPVGEQPEEPEEPEQPEPPVGEQPEQPEEPEQPEPP
VGEQPEQPEEPEQPEPPVGEQPEQPEEPEQPEPPVGEQPEQPEEPEQPEPPVGEQPEQPEEPEQPEPPVGEQPEEPEQPEPPVGEQPEEPEEPEQPEPPVDEQPEEPEEPDEGGGQPNVSFGTIGDDDFSEIDVPDAVPGDSSILFTGAGNDFINTVGNPLSNTVYAGSGDDILIAGNEDRFFGQAGDDQ
FFITDQGDNILNGGAGTDTFNLANAELPSGINTVSDFTQGEDIIGINGFEDLTFEDLSLTQSENDTILGLSGQDFATLSGVEADTLEADDFVFG
Molecular weight: 51.51 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|K9Y9E7|K9Y9E7_HALP7 50S ribosomal protein L34
MAQQTLQGTRLKQKRKLGFRARMRTHNGRKIINARRKKGRARLSV
Molecular weight: 5.32 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,666 |
35 |
3,701 |
1,167,376 |
29 |
3,389 |
318.4 |
35.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.66 |
0.95 |
5.02 |
7.25 |
4.0 |
6.6 |
1.85 |
6.43 |
4.61 |
10.97 |
1.84 |
4.19 |
5.79 |
4.71 |
5.07 |
6.34 |
5.79 |
6.43 |
1.42 |
3.06 |
Note: For statistics only major isoforms were used (in this case 3,666 proteins)
For dipeptide frequency statistics click
here