Torque teno felis virus (isolate Fc-TTV4)
Average proteome isoelectric point is 6.36
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q8QVL5|ORF3_TTVF1 Uncharacterized ORF3 protein
MSASHSLSQSPNLHPDFTYKRQEALWKQLVSAEHRKFCSCGDYTQHFRFPSPVKEDECIRVVGEEGGDGVAVSYHVTKESGDEDPEEVMASIAVGDDGDDDLELCKWNLKPEPLILKQTDPQPLLTSSPGISTVMGSSKTRLMNELLEIIHALSGPDPWESDGGMGPQGEPSKSNSRLLYSDPNPEDSSS
DDSEMSYFSSSDSTDADITYPNMEGGRTPPRYPPPNMGIYF
Molecular weight: 25.41 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q8QVL3|CAPSD_TTVF1 Capsid protein
MYQSRRRRRRRWGRRILSRYKRKWGRRSRRGHGIYRRWRRWRRRPRTVVTEQHSRRVKTIIVRGWEPLGNICPTDSARAKATPYASYDSDSGQGQWHGTWGHHWFTFQSLVDRAEARLNSFSGNWESYDYLRFLGGTMYFMQPREMCFMFGNDPYLMTSDLDKTASQKNRAEETWITPGYLMHRPGTHLI
LSRQKVERRSMYKIRVPVPTSWRGWFPIPDCFSYVLCHWYWTWWDPDACFFDPCATGSSCEAEPWWSTAQTKQAWVDRTKLDDPPVGGTGPNQKTWAPFLPSRPCTNYYTHSASFWFKYKLKFQVTGENIWAPVPRDYSQRGTVPTAPSRQQVESEARAPYPKTNRPPTTADILPGDLDSDGILEDEAYE
RITRDNPCPKRPRPLGIRWWDGTPGRTLQEQQQAAVLRPKPRRQLLRRLRDVLLQL
Molecular weight: 51.7 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3 |
0 |
3 |
772 |
105 |
436 |
257.3 |
29.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.79 |
2.07 |
7.25 |
6.09 |
3.24 |
6.99 |
2.59 |
3.11 |
4.15 |
6.48 |
2.33 |
2.33 |
4.15 |
8.29 |
8.94 |
9.07 |
5.83 |
4.66 |
3.76 |
3.89 |
Note: For statistics only major isoforms were used (in this case 3 proteins)
For dipeptide frequency statistics click
here