Virtual 2D-PAGE plot for 3,155 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|U2YMC5|U2YMC5_9MICO Serine/threonine protein kinase
MALALAAGGLVLGVGAIVTLAVWNDSEFATGTFGAGSFDLQGSTDGTTFTSDAAAPGKTLTFTLDADADALAPDDVVYAPFAVQLSGTSTNEAAVSVENVIGGAIGDDLTYSLFVEDDFGVTCSAATPPTGTEVVADRAADATGTVDVFDLTAAGTPVNLCFVVTAGAIEQGEAGTITWEFAGTSGDTLP
Molecular weight: 18.82 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|U2YQY4|U2YQY4_9MICO Uncharacterized protein
MERAQSAAVRRARALRGTASAAIATVFAATAHTISGGLAPLWLIVVATLLAAPAAVWLVGRAPSAWRTGLVVLASQGLFHTFFSIAGAADPTAPVPHTHGGGLPALAPLAHTHAVSSGMTATHVLAAAVTVATLVAGERLVRAIHRGILRFVRLMSPSVRARTPMLRPVPRRERVAAARRLRFSLSLRGP PVATV
Molecular weight: 20.26 kDa Isoelectric point according different methods: