Campylobacter curvus (strain 525.92)
Average proteome isoelectric point is 6.81
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,858 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A7GWS2|A7GWS2_CAMC5 Uncharacterized protein
MKVALVNKNPAVSRLITLSLNKIGAQYTEFDDISGLDHSFDYVIVDSDIDTGDFDFSGFDSVMYLVPRGGQKPEFATTSLEKPFLPTEFINIFEQSKPNTANFAKDDAMSDFSDFDDTHAAQLEDENFELPKIDEELQEETDLNIDDIDLEDIKLDELDLGEEDEVATDGAEDADKLADEIELDETDFEE
KVLDAGEAEQNLASQDSFDDDDLAKDLLPQNDDNSDMNELSSLVDEIENMDDTPKHSDQDEISAEPKSDDETKFDTMNDVSDEPKDEFVSDIDATKNALNEIEALDDLNEEENLQNLDESAAAEESDFDEPEESEAKDNLVDTLADDFDGSDEEFSTEVAQTIDENTLDAKLEEASDLNLDEQIDDAQLN
DELINSTLSDENLDQDEPKIQIVDETNEATDEPQQEILQDVAIDESDLDAKLEQAVDLNSDEPSENTQPNSIDEIDEADMLKAFGLKGEAPTAKEEKSGKNPQDIKAELTKKITEHITSSLDESSIKEALKDMNIKINISFEEK
Molecular weight: 58.45 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A7GYZ6|A7GYZ6_CAMC5 50S ribosomal protein L34
MKRTYQPHKTPKKRTHGFRLRMKTKNGRKVINARRAKGRKRLAA
Molecular weight: 5.27 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,858 |
0 |
1,858 |
585,512 |
37 |
1,787 |
315.1 |
35.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.3 |
1.14 |
5.6 |
6.57 |
5.46 |
6.65 |
1.56 |
7.96 |
8.17 |
9.77 |
2.5 |
5.18 |
2.87 |
2.99 |
3.87 |
6.55 |
4.32 |
6.35 |
0.72 |
3.47 |
Note: For statistics only major isoforms were used (in this case 1,858 proteins)
For dipeptide frequency statistics click
here