Virtual 2D-PAGE plot for 6,684 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|D0LL38|D0LL38_HALO1 Thrombospondin type 3 repeat protein
MDCQSPAPTKTPYLTAATGLLLALALLIPACDLVQSREYDDSARDDDGVLYYEDNCPNTANADQADQDGDNVGDACDVCPGIADSGADSDGDGVGDACDNCVDAFNPDQANSSADDFGDACDADRDGVLDVEDNCPTTANSDQADADSDSFGDACDNCVEVANEDQANSDDDGFGDACDNCVNFSSDDQT DADADQIGDVCADFSDNDYDGDGVGNDADNCPTTANEDQADGDEDGVGDACDNCAEDANPDQANSDNDSVGDACDNCPGVDNDDQANADEDSEDDVGGDACS
Molecular weight: 29.89 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|D0LU90|D0LU90_HALO1 Uncharacterized protein
MATGRRTKRSLKDRPKHRQARALKTRRRKAKQAASRKRGLNKSRARRRTRQGRSGKRVIR
Molecular weight: 7.15 kDa Isoelectric point according different methods: