Candidatus Nomurabacteria bacterium GW2011_GWB1_47_6
Average proteome isoelectric point is 7.24
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 581 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1VAZ3|A0A0G1VAZ3_9BACT Outer membrane autotransporter (Fragment)
VVLNDGDGNSNVAYTTVTANTLKIDANAPTLVSAQTTSTTTIDVTFNEDLNGATPTNADFLVAGVNPVNTDEISAGVIQLTVAVPFSTDATPAVEYVGSVTDLAGNPAALFGPITPDDGVAPVLAEVAPVPTPDNDSTPDYTFSAGEAGAISYGGDCSSATAVAVVGPNTITFNSLSDGPHSNCTITVTD
SSGNASLALAVSSFTIDTVPPSVVLSSLVTDPTNDSPILVTATFSEDVTGFSGPFDIGIVNGTLQTFTQISGSIYNFNVLPASQGLVTVDVDANSAIDTAGNDNTAATQFGITYDSVPPVITMLGASPVNIEYGETYIDDGAIASDPLPGDGDVTGSIVVVDPVDTSTLGTYLVTYNVADTAGNNAIEVT
RTVNVVPRAITVTAVTDTKVYDGGPDSSGTPTITSGSPAFGDGEDFVQSFDTKDVGVGKTLAPSGVIF
Molecular weight: 45.14 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1W0B6|A0A0G1W0B6_9BACT Uncharacterized protein
MKTNKSYSKRLKLTKNGKVISRKAGFNHFNAKQSRRKQLAGRSGVGFVIKNKPKSHLMPFN
Molecular weight: 6.96 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
577 |
4 |
581 |
160,675 |
23 |
1,438 |
278.5 |
31.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.84 |
0.78 |
5.06 |
7.15 |
4.75 |
7.22 |
1.79 |
7.27 |
7.98 |
9.46 |
2.21 |
4.17 |
2.86 |
4.15 |
4.88 |
6.17 |
5.24 |
6.72 |
1.05 |
3.23 |
Note: For statistics only major isoforms were used (in this case 577 proteins)
For dipeptide frequency statistics click
here