Microgenomates group bacterium GW2011_GWB1_40_9
Average proteome isoelectric point is 7.46
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 568 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G0TVB4|A0A0G0TVB4_9BACT Uncharacterized protein
MFQFRLLRMAFVPWMIFAFAVASTGVYSFITVPSVEALTTFSIKAGGYYGNGASLSISGLGFTPEAVIVRSDAALSSIWQSSAASGTTATYLGIVTADNTGSGIALSADGFTVSPVPETNTVNIHYTYFALAGSGCSPEGMLCVGLYTGDGTASRTISVGNSSTSTASNVVGSFTVGLADNTNGNVYHYV
AFKNVTPVPAYESVPSSGGGSGSPTTGGGSLTGGSDPGDPGQSSATPGDVGTVGESTGETGVAPSSESSSSVSVSDAVGFGISNSVTGAVASAIGIGPAPSSPAAVGMSAVGLGLSMGLGPVGMAVAIGLAIADAVTDGQVSNSVDAVTGGLFSAIGNAVIGVANAVTGFFGGLFGDEGTPVGEPGYGLG
ESAPGTPGSSAGVGSGTGVGSGASGDPGTGGEGPGGPGAPGDGSGGDGGGDGGK
Molecular weight: 41.07 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0W405|A0A0G0W405_9BACT Preprotein translocase subunit E (Fragment)
LKKTTWPTRQETIKLTVIVIALSLIVGAFIGVLDTIFLRISGLLFRR
Molecular weight: 5.31 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
568 |
0 |
568 |
160,002 |
21 |
6,992 |
281.7 |
31.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.82 |
0.89 |
4.79 |
5.84 |
4.54 |
6.69 |
2.12 |
8.58 |
7.16 |
9.45 |
2.38 |
3.8 |
3.66 |
4.25 |
4.49 |
6.31 |
6.53 |
6.96 |
1.2 |
3.55 |
Note: For statistics only major isoforms were used (in this case 568 proteins)
For dipeptide frequency statistics click
here