Torque teno sus virus 1 (isolate Sd-TTV31)
Average proteome isoelectric point is 6.53
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q8QVM0|ORF2_TTVI1 Uncharacterized ORF2 protein
MKEKDYWEEAWLTSCTSIHDHHCDCGSWRDHLWTLCALDDADLAAAADIIEREEADGGEDFGFVDGDPGDAGG
Molecular weight: 8.04 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q8QVL9|CAPSD_TTVI1 Capsid protein
MRFRRRRFGRRRRYYRKRRGGWRRRFRIRRRRPWRRWRVRRWRRSVFRRRGRRARPYRISAWNPKVLRNCRITGWWPVIQCMDGMEWIKYKPMDLRVEANRIFDKQGSKIETEQMGYLMQYGGGWSSGVISLEGLFNENRLWRNIWSKSNDGMDLVRYFGCRIRLYPTENQGYLFWYDTEFDEQQRRMLD
EYTQPSVMLQAKNSRLIVCKQKMPIRRRVKSIFIPPPAQLTTQWKFQQELCQFPLFNWACICIDMDTPFDYNGAWRNAWWLMRRLQNGNMEYIERWGRIPMTGDTELPPADDFKAGGVNKNFKPTGIQRIYPIVAVCLVEGNKRVVKWATVHNGPIDRWRKKQTGTLKLSALRRLVLRVCSESETYYKWT
ASEFTGAFQQDWWPVSGTEYPLCTIKMEPEFENPTVEVWSWKATIPTAGTLKDYFGLSSGQQWKDTDFGRLQLPRSSHNVDFGHKARFGPFCVKKPPVEFRDSAPNPLNIWVKYTFYFQFGGMYQPPTGIQDPCTSNPTYPVRMVGAVTHPKYAGQGGIATQIGDQGITAASLRAISAAPPNTYTQSAFL
KAPETEKEEERESETSFTSAESSSEGDGSSDDQAERRAARKRVIKLLLKRLADRPVDNKRRRFSE
Molecular weight: 74.96 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3 |
0 |
3 |
932 |
73 |
635 |
310.7 |
36.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.22 |
2.25 |
6.76 |
6.22 |
4.08 |
6.65 |
1.5 |
4.4 |
5.79 |
6.65 |
2.25 |
2.9 |
3.97 |
6.55 |
10.41 |
6.76 |
5.58 |
4.18 |
3.97 |
2.9 |
Note: For statistics only major isoforms were used (in this case 3 proteins)
For dipeptide frequency statistics click
here