Kitasatospora cheerisanensis KCTC 2395
Taxonomy: cellular organisms; Bacteria; Terrabacteria group; Actinobacteria; Actinobacteria; Streptomycetales; Streptomycetaceae; Kitasatospora; Kitasatospora cheerisanensis
Average proteome isoelectric point is 7.17
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 7,804 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|A0A066ZBF4|A0A066ZBF4_9ACTN Lantibiotic protein
MADTSLASLAEEILNLESETFEISDYSDTSEVMLGSSTSCSSTSTCSSTTSTTSCTA
MADTSLASLAEEILNLESETFEISDYSDTSEVMLGSSTSCSSTSTCSSTTSTTSCTA
Molecular weight: 5.87 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A066YSN3|A0A066YSN3_9ACTN Uncharacterized protein
MAVGAGSGGRRGRWRGLPGSGRGRRVRVGRGRWRRLRVRQPVSVPRAGRGHPCRAAAPRGGGRCARAAGRPAAAGWGSGGRSRRRPGRCRTARPARTGTAAPAAASRRPPAVRAGRRRSARTAAGRGAPRSRWAAGRPARRRPARRAARGRRRPAAGGPRRARRRTGRGARRGRSGGRRRAAGGRRRPAR
AASGRPVRRAGRPTTGCRAAVPRGRAPSSRRPTGRPRRGRRGCRRRRSGARGSPGSGGGRRRAAGRARCGRR
MAVGAGSGGRRGRWRGLPGSGRGRRVRVGRGRWRRLRVRQPVSVPRAGRGHPCRAAAPRGGGRCARAAGRPAAAGWGSGGRSRRRPGRCRTARPARTGTAAPAAASRRPPAVRAGRRRSARTAAGRGAPRSRWAAGRPARRRPARRAARGRRRPAAGGPRRARRRTGRGARRGRSGGRRRAAGGRRRPAR
AASGRPVRRAGRPTTGCRAAVPRGRAPSSRRPTGRPRRGRRGCRRRRSGARGSPGSGGGRRRAAGRARCGRR
Molecular weight: 27.93 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
2,301,159 |
37 |
4,988 |
296.9 |
31.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
14.57 |
0.84 |
5.69 |
5.28 |
2.54 |
9.76 |
2.39 |
2.73 |
1.74 |
10.66 |
1.54 |
1.71 |
2.89 |
6.77 |
8.67 |
4.81 |
5.94 |
8.04 |
1.53 |
1.9 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |