Oscillatoria nigro-viridis PCC 7112
Average proteome isoelectric point is 6.39
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 6,276 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|K9VP81|K9VP81_9CYAN Uncharacterized protein
MAFFDTFSVALKQKWLDYYQVNRAWLLLHMTADNTVATPDGGKRPVSYLILGIAAALEPELQQLMLPFSKLKPDADSLIEVLGLNFDPDIALGMPSNIAQQTIGTSPTPAATQTATTAPAVAQTATAAPAAAQTATAAPAAKSNKLGGAALAAAGVAAGVAGAAGLAAAASALSSEEESFDEFEEEAVSD
FDMGDEEEEAVSDFDMGDEEEEAVSDFDMGDEEEEAVSDFDMGDEEEEASALDGLGLEEDEEDAVSDFDMGDDEEDAVSDFDMGDDEEDAVSDFDMGDDEEEEALALGGLDLGDDDEEEEALALGGLDLGDDEEEEASALGGLDLGDDEEEEASQFGTLTSGDLESEISDPFGEEDAEFVAEEIPDPFGT
ATSDDLDMDLGDLDDDGIDDFSVSDDDDLDDLGLDDLGEATTGDPDEDDLDALGLGDLDSDDEDEEISGFLSDFK
Molecular weight: 47.68 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|K9VC65|K9VC65_9CYAN 50S ribosomal protein L34
MTQQTLHGTSRKRKRTSGFRARMRTVTGRLVIKARRSKGRHRLAV
Molecular weight: 5.25 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
6,234 |
42 |
6,276 |
2,095,345 |
30 |
7,380 |
336.1 |
37.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.69 |
1.05 |
5.08 |
6.48 |
3.88 |
6.87 |
1.64 |
6.39 |
4.91 |
10.63 |
1.82 |
4.35 |
4.96 |
4.9 |
5.29 |
6.62 |
5.58 |
6.58 |
1.37 |
2.91 |
Note: For statistics only major isoforms were used (in this case 6,234 proteins)
For dipeptide frequency statistics click
here